PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000215675
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 365aa    MW: 40712.7 Da    PI: 4.6151
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000215675genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.86.6e-151764148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++ Ed++lv  +++ G ++W++ +r+ g+ R++k+c++rw +yl
    MDP0000215675 17 RGPWSPAEDLKLVTFIQKNGHHNWRALPRRAGLMRCGKSCRLRWINYL 64
                     89********************************************97 PP

2Myb_DNA-binding51.52.3e-1670115148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T eE+e + ++++ lG++ W+tIa++++ gRt++++k+ w+++l
    MDP0000215675  70 RGNFTREEEESIMKLHEALGNK-WSTIAAHFP-GRTDNEIKNVWNTHL 115
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.7061264IPR017930Myb domain
SuperFamilySSF466892.31E-2815111IPR009057Homeodomain-like
SMARTSM007172.6E-101666IPR001005SANT/Myb domain
PfamPF002491.6E-131764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-211871IPR009057Homeodomain-like
CDDcd001674.11E-91964No hitNo description
PROSITE profilePS5129424.14665119IPR017930Myb domain
SMARTSM007173.6E-1369117IPR001005SANT/Myb domain
PfamPF002492.2E-1470115IPR001005SANT/Myb domain
CDDcd001672.62E-972115No hitNo description
Gene3DG3DSA:1.10.10.601.1E-2672119IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MGEKGKSLCC DKEQVRRGPW SPAEDLKLVT FIQKNGHHNW RALPRRAGLM RCGKSCRLRW  60
INYLSPDVKR GNFTREEEES IMKLHEALGN KWSTIAAHFP GRTDNEIKNV WNTHLKKRLA  120
CRNLSSLTSS SSSSSSTTTT LLSSGKSTVG GGDELIEHQS ADQETSMATN NKPHEPCSLT  180
IQENPNHQDF PMELTNDPKG LKELTTSSNV SSNESNGSSN SSQVVGMSRP GAEEQQMDDD  240
SIDLSGIFDN PFEYDSDFWN LLDDFQPLQS NEVQVLHEAD EANYQSSGLG HVENGNCLSY  300
LQSELGFEAA ATESEINNQE ILPKDATEQP VIPETFDKMP NPAGYDERMD YFQTWLSSPQ  360
NNSTI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-24171194105C-Myb DNA-Binding Domain
1msf_C1e-24171194105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008383122.10.0PREDICTED: myb-related protein Zm1-like
TrEMBLM5WMX01e-117M5WMX0_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100293042
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G16490.19e-65myb domain protein 58